PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27899.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 368aa    MW: 41360.9 Da    PI: 6.2422
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27899.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+ +++ +G g W+ I+ + g++R++k+c++rw +yl
       KFK27899.1 14 KGAWTTEEDKKLISYIHDHGEGGWRDIPGKAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.21e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
       KFK27899.1  67 RGEFSFEEEQIIIMLHASRGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.966961IPR017930Myb domain
SuperFamilySSF466896.74E-2811108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002496.5E-161461IPR001005SANT/Myb domain
CDDcd001675.39E-101661No hitNo description
PROSITE profilePS5129423.36962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465117IPR009057Homeodomain-like
SMARTSM007171.8E-1466114IPR001005SANT/Myb domain
PfamPF002492.8E-1367112IPR001005SANT/Myb domain
CDDcd001672.18E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH DHGEGGWRDI PGKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SFEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIEQG  120
LDPVTHKPLA SNSTVAENLH SVNVPSSDKQ YPRSSSMPSL SPPPSGSEMT KSSNSDGTPA  180
QGGFLSCKKR FKKSSSTSRL LNRVAAKATS MKDILSASME GSLNATTISH ASFFNGFSEQ  240
IRNEQDNSNV SLTNTFDEFD PFSPFSQSSL YTEQEINATF DLGMDQGYDF SHFLEKLGAD  300
NPKEEKSYMN VEYGHELLMS DVSQEVSSTS VDDQDNMIGN FEGWSSYLLD HTDFIYDTDS  360
DSLEKHSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866434.10.0hypothetical protein ARALYDRAFT_919385
SwissprotQ9SPG20.0MYB28_ARATH; Transcription factor MYB28
TrEMBLA0A087GDE70.0A0A087GDE7_ARAAL; Uncharacterized protein
STRINGscaffold_802785.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.20.0myb domain protein 28